Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFML3 Rabbit Polyclonal Antibody (HRP)

OLFML3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OLF44, HNOEL-iso

UniProt

Q9NRN5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human OLFML3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WSGPLQGQQHHLVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064575

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPA Receptor/PLAUR Rabbit Polyclonal Antibody (Fluoro550)
orb3115938 100 µg

UPA Receptor/PLAUR Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Bag2 3'UTR Luciferase Stable Cell Line
TU102506 1.0 mL

Bag2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PSMB6 sgRNA CRISPR Lentivector set (Human)
K1740101 3x 1.0 µg

PSMB6 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Delftia acidovorans 8-amino-7-oxononanoate synthase (bioF)
MBS1055973-01 0.02 mg (E-Coli)

Recombinant Delftia acidovorans 8-amino-7-oxononanoate synthase (bioF)

Sign In for Pricing
View Details
Recombinant Delftia acidovorans 8-amino-7-oxononanoate synthase (bioF)
MBS1055973-02 0.02 mg (Yeast)

Recombinant Delftia acidovorans 8-amino-7-oxononanoate synthase (bioF)

Sign In for Pricing
View Details
Recombinant Delftia acidovorans 8-amino-7-oxononanoate synthase (bioF)
MBS1055973-03 0.1 mg (E-Coli)

Recombinant Delftia acidovorans 8-amino-7-oxononanoate synthase (bioF)

Sign In for Pricing
View Details