Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Saa1 Rabbit Polyclonal Antibody (Biotin)

Saa1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Sa, Saa2, Saa-1

UniProt

P05366

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Saa1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033143

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cacybp shRNA (UAS) - Lentiviral mouse Cacybp shRNA (UAS, iRFP) (100)
GTR15213747 1 Vial

Lentiviral mouse Cacybp shRNA (UAS) - Lentiviral mouse Cacybp shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Anti-SLIRP Antibody Picoband® Fluoro647 Conjugated
A08297-1-Fluoro647 100 µg/Vial

Anti-SLIRP Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Phosphatidylglycerol Antibody (IgA) Human ELISA Kit
F8319 96 Tests

Phosphatidylglycerol Antibody (IgA) Human ELISA Kit

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)
MBS2146498-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)
MBS2146498-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)
MBS2146498-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Phosphoglycerate Mutase 1, Brain (PGAM1)

Sign In for Pricing
View Details