Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Saa1 Rabbit Polyclonal Antibody (HRP)

Saa1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sa, Saa2, Saa-1

UniProt

P05366

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Saa1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033143

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Kif24 shRNA (UAS) - Lentiviral mouse Kif24 shRNA (UAS) (25)
GTR15223553 1 Vial

Lentiviral mouse Kif24 shRNA (UAS) - Lentiviral mouse Kif24 shRNA (UAS) (25)

Sign In for Pricing
View Details
Optimedin Rabbit Polyclonal Antibody (APC-Cy7)
orb2548037 100 µL

Optimedin Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
SPNS1 Rabbit Polyclonal Antibody (RBITC)
orb1040282 100 µL

SPNS1 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
GRK1 Rabbit Polyclonal Antibody (BF405)
orb2549517 100 µL

GRK1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
FES Antibody
orb1273739 0.1 mL

FES Antibody

Sign In for Pricing
View Details
Recombinant Mouse Phosphatidylinositol N-acetylglucosaminyltransferase subunit C (Pigc)
orb2915838-01 20 µg

Recombinant Mouse Phosphatidylinositol N-acetylglucosaminyltransferase subunit C (Pigc)

Sign In for Pricing
View Details