Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC30A8 Rabbit Polyclonal Antibody (HRP)

SLC30A8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNT8, ZnT-8

UniProt

Q8IWU4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC30A8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_776250

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pygb shRNA (UAS) - Lentiviral mouse Pygb shRNA (UAS, GFP) plasmid
GTR15128638 1 Vial

Lentiviral mouse Pygb shRNA (UAS) - Lentiviral mouse Pygb shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Recombinant Hypoxanthine Phosphoribosyltransferase 1 (HPRT1)
SIPA545Mu02-01 10 µg

Recombinant Hypoxanthine Phosphoribosyltransferase 1 (HPRT1)

Sign In for Pricing
View Details
Recombinant Hypoxanthine Phosphoribosyltransferase 1 (HPRT1)
SIPA545Mu02-02 50 µg

Recombinant Hypoxanthine Phosphoribosyltransferase 1 (HPRT1)

Sign In for Pricing
View Details
Recombinant Hypoxanthine Phosphoribosyltransferase 1 (HPRT1)
SIPA545Mu02-03 200 µg

Recombinant Hypoxanthine Phosphoribosyltransferase 1 (HPRT1)

Sign In for Pricing
View Details
Recombinant Hypoxanthine Phosphoribosyltransferase 1 (HPRT1)
SIPA545Mu02-04 1 mg

Recombinant Hypoxanthine Phosphoribosyltransferase 1 (HPRT1)

Sign In for Pricing
View Details
Recombinant Hypoxanthine Phosphoribosyltransferase 1 (HPRT1)
SIPA545Mu02-05 5 mg

Recombinant Hypoxanthine Phosphoribosyltransferase 1 (HPRT1)

Sign In for Pricing
View Details