Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBP2 Rabbit Polyclonal Antibody (FITC)

FBP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC142192

UniProt

O00757

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FBP2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_003828

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2H2C Rabbit pAb, BF700 conjugated
orb2864237 100 µL

GTF2H2C Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
EKLF (Krueppel-like Factor 1, Erythroid krueppel-like Transcription Factor, EKLF, KLF1, EKLF, Krueppel-like Factor 5, Basic Transcription Element-Binding Protein 2, BTE-Binding Protein 2, Colon krueppel-like Factor, GC-box-Binding Protein 2, Intestinal-enriched krueppel-like Factor, Transcription Factor BTEB2, KLF5, BTEB2, CKLF, IKLF, Krueppel-like Factor 7, Ubiquitous krueppel-like Factor, KLF7, UKLF, Krueppel-like Factor 4, Epithelial zinc Finger Protein EZF, Gut-enriched krueppel-like Factor, KLF4, EZF, GKLF) discontinued
222387-01 50 µL

EKLF (Krueppel-like Factor 1, Erythroid krueppel-like Transcription Factor, EKLF, KLF1, EKLF, Krueppel-like Factor 5, Basic Transcription Element-Binding Protein 2, BTE-Binding Protein 2, Colon krueppel-like Factor, GC-box-Binding Protein 2, Intestinal-enriched krueppel-like Factor, Transcription Factor BTEB2, KLF5, BTEB2, CKLF, IKLF, Krueppel-like Factor 7, Ubiquitous krueppel-like Factor, KLF7, UKLF, Krueppel-like Factor 4, Epithelial zinc Finger Protein EZF, Gut-enriched krueppel-like Factor, KLF4, EZF, GKLF) discontinued

Sign In for Pricing
View Details
EKLF (Krueppel-like Factor 1, Erythroid krueppel-like Transcription Factor, EKLF, KLF1, EKLF, Krueppel-like Factor 5, Basic Transcription Element-Binding Protein 2, BTE-Binding Protein 2, Colon krueppel-like Factor, GC-box-Binding Protein 2, Intestinal-enriched krueppel-like Factor, Transcription Factor BTEB2, KLF5, BTEB2, CKLF, IKLF, Krueppel-like Factor 7, Ubiquitous krueppel-like Factor, KLF7, UKLF, Krueppel-like Factor 4, Epithelial zinc Finger Protein EZF, Gut-enriched krueppel-like Factor, KLF4, EZF, GKLF) discontinued
222387-02 100 µL

EKLF (Krueppel-like Factor 1, Erythroid krueppel-like Transcription Factor, EKLF, KLF1, EKLF, Krueppel-like Factor 5, Basic Transcription Element-Binding Protein 2, BTE-Binding Protein 2, Colon krueppel-like Factor, GC-box-Binding Protein 2, Intestinal-enriched krueppel-like Factor, Transcription Factor BTEB2, KLF5, BTEB2, CKLF, IKLF, Krueppel-like Factor 7, Ubiquitous krueppel-like Factor, KLF7, UKLF, Krueppel-like Factor 4, Epithelial zinc Finger Protein EZF, Gut-enriched krueppel-like Factor, KLF4, EZF, GKLF) discontinued

Sign In for Pricing
View Details
ESI-08
BA5778-1 1 mg

ESI-08

Sign In for Pricing
View Details
MTRR Knockout MES-OV Polyclonal Cells
ARG6464 1 Million

MTRR Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
MIA3 Knockout Hela Polyclonal Cells
ARG8234 1 Million

MIA3 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details