Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNASE9 Rabbit Polyclonal Antibody (FITC)

RNASE9 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RAK1, h461, HEL128

UniProt

P60153

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RNASE9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001001673

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Heat Shock Protein Beta 8 ELISA Kit
MBS097808 Inquire

Goat Heat Shock Protein Beta 8 ELISA Kit

Sign In for Pricing
View Details
Lentiviral human ZCCHC2 shRNA (UAS) - Lentiviral human ZCCHC2 shRNA (UAS, GFP) (100)
GTR15347748 1 Vial

Lentiviral human ZCCHC2 shRNA (UAS) - Lentiviral human ZCCHC2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
RNH1 (Ribonuclease Inhibitor, Placental Ribonuclease Inhibitor, Placental RNase Inhibitor, Ribonuclease/Angiogenin Inhibitor 1, RAI, PRI, RNH) (MaxLight 405) discontinued
132707-ML405 100 µL

RNH1 (Ribonuclease Inhibitor, Placental Ribonuclease Inhibitor, Placental RNase Inhibitor, Ribonuclease/Angiogenin Inhibitor 1, RAI, PRI, RNH) (MaxLight 405) discontinued

Sign In for Pricing
View Details
N-nitroso Nilvadipine
CS-O-39148 1 Each

N-nitroso Nilvadipine

Sign In for Pricing
View Details
Ip6k1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4995702 1.0 µg DNA

Ip6k1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Plasmodium vivax MSP1 (Plasmodium vivax merozoite surface protein 1) (MaxLight 490)
MBS6254191-01 0.1 mL

Plasmodium vivax MSP1 (Plasmodium vivax merozoite surface protein 1) (MaxLight 490)

Sign In for Pricing
View Details