Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tekt1 Rabbit Polyclonal Antibody (HRP)

Tekt1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MT14

UniProt

Q9DAJ2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Tekt1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035699

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PI4K2A shRNA (UAS) - Lentiviral human PI4K2A shRNA (UAS, iRFP) (100)
GTR15126855 1 Vial

Lentiviral human PI4K2A shRNA (UAS) - Lentiviral human PI4K2A shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CCR9 (C-C chemokine receptor type 9, CC-CKR-9, C-C CKR-9, CCR-9, CDw199, GPR28, GPR-9-6, G-protein coupled receptor 28) (MaxLight 650)
C2100-10M1-ML650 100 µL

CCR9 (C-C chemokine receptor type 9, CC-CKR-9, C-C CKR-9, CCR-9, CDw199, GPR28, GPR-9-6, G-protein coupled receptor 28) (MaxLight 650)

Sign In for Pricing
View Details
Anti-Phospho-COXIV (Ser58) COX4I1 Antibody
P05442 100 µL

Anti-Phospho-COXIV (Ser58) COX4I1 Antibody

Sign In for Pricing
View Details
Zfp207 Recombinant Protein (Mouse)
RP186749 100 µg

Zfp207 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
PHF7 Recombinant Protein (Human)
RP023341 100 µg

PHF7 Recombinant Protein (Human)

Sign In for Pricing
View Details
Chicken Chemokine C-C-Motif Ligand 1 ELISA Kit
MBS738952-01 48 Well

Chicken Chemokine C-C-Motif Ligand 1 ELISA Kit

Sign In for Pricing
View Details