Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGK1 Rabbit Polyclonal Antibody (Biotin)

PGK1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PGKA, MIG10, HEL-S-68p

UniProt

P00558

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PGK1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_000282

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MicroLoop Assembly; box of 20 assemblies
B-M5-100-B3-R 20 Mounts/Base Assemblies

MicroLoop Assembly; box of 20 assemblies

Sign In for Pricing
View Details
Mouse Carnitine O-palmitoyltransferase 2, mitochondrial (CPT2) ELISA Kit
MBS282177-01 48 Tests

Mouse Carnitine O-palmitoyltransferase 2, mitochondrial (CPT2) ELISA Kit

Sign In for Pricing
View Details
Mouse Carnitine O-palmitoyltransferase 2, mitochondrial (CPT2) ELISA Kit
MBS282177-02 96 Tests

Mouse Carnitine O-palmitoyltransferase 2, mitochondrial (CPT2) ELISA Kit

Sign In for Pricing
View Details
Mouse Carnitine O-palmitoyltransferase 2, mitochondrial (CPT2) ELISA Kit
MBS282177-03 5x 96 Tests

Mouse Carnitine O-palmitoyltransferase 2, mitochondrial (CPT2) ELISA Kit

Sign In for Pricing
View Details
Mouse Carnitine O-palmitoyltransferase 2, mitochondrial (CPT2) ELISA Kit
MBS282177-04 10x 96 Tests

Mouse Carnitine O-palmitoyltransferase 2, mitochondrial (CPT2) ELISA Kit

Sign In for Pricing
View Details
Bendamustine HCl
C07620-100mg 100 mg

Bendamustine HCl

Sign In for Pricing
View Details