Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGK1 Rabbit Polyclonal Antibody (HRP)

PGK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PGKA, MIG10, HEL-S-68p

UniProt

P00558

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PGK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_000282

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Mesencephalic Astrocyte Derived Neurotrophic Factor (MANF) ELISA Kit
DLR-MANF-Hu-48T 48 Tests

Human Mesencephalic Astrocyte Derived Neurotrophic Factor (MANF) ELISA Kit

Sign In for Pricing
View Details
CHUK (conserved Helix-loop-Helix ubiquitous Kinase, IKBKA, IKK-alpha, IKK1, IKKA, NFKBIKA, TCF16) (HRP)
MBS6180526-01 0.1 mL

CHUK (conserved Helix-loop-Helix ubiquitous Kinase, IKBKA, IKK-alpha, IKK1, IKKA, NFKBIKA, TCF16) (HRP)

Sign In for Pricing
View Details
CHUK (conserved Helix-loop-Helix ubiquitous Kinase, IKBKA, IKK-alpha, IKK1, IKKA, NFKBIKA, TCF16) (HRP)
MBS6180526-02 5x 0.1 mL

CHUK (conserved Helix-loop-Helix ubiquitous Kinase, IKBKA, IKK-alpha, IKK1, IKKA, NFKBIKA, TCF16) (HRP)

Sign In for Pricing
View Details
MAPK10 Protein Vector (Mouse) (pPB-N-His)
PV199055 500 ng

MAPK10 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Phospho-GEF H1 (Ser886) Rabbit Polyclonal Antibody (HRP)
orb504012 100 µL

Phospho-GEF H1 (Ser886) Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Prosthecochloris vibrioformis Homoserine kinase (thrB)
MBS1214255-01 0.05 mg (E-Coli)

Recombinant Prosthecochloris vibrioformis Homoserine kinase (thrB)

Sign In for Pricing
View Details