Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNN1 Rabbit Polyclonal Antibody (FITC)

CNN1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SMCC, Sm-Calp, HEL-S-14

UniProt

P51911

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CNN1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNF

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001290

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf63 (Chromosome 10 Open Reading Frame 63, DKFZp781F21103, MGC26778) (MaxLight 405)
MBS6194722-01 0.1 mL

C10orf63 (Chromosome 10 Open Reading Frame 63, DKFZp781F21103, MGC26778) (MaxLight 405)

Sign In for Pricing
View Details
C10orf63 (Chromosome 10 Open Reading Frame 63, DKFZp781F21103, MGC26778) (MaxLight 405)
MBS6194722-02 5x 0.1 mL

C10orf63 (Chromosome 10 Open Reading Frame 63, DKFZp781F21103, MGC26778) (MaxLight 405)

Sign In for Pricing
View Details
Mouse Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2, MAGI2 ELISA Kit
MBS9333715-01 48 Well

Mouse Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2, MAGI2 ELISA Kit

Sign In for Pricing
View Details
Mouse Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2, MAGI2 ELISA Kit
MBS9333715-02 96 Well

Mouse Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2, MAGI2 ELISA Kit

Sign In for Pricing
View Details
Mouse Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2, MAGI2 ELISA Kit
MBS9333715-03 5x 96 Well

Mouse Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2, MAGI2 ELISA Kit

Sign In for Pricing
View Details
Mouse Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2, MAGI2 ELISA Kit
MBS9333715-04 10x 96 Well

Mouse Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2, MAGI2 ELISA Kit

Sign In for Pricing
View Details