Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1A1 Rabbit Polyclonal Antibody (Biotin)

EEF1A1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CCS3, EF1A, PTI1, CCS-3, EE1A1, EEF-1, EEF1A, EF-Tu, LENG7, eEF1A-1, GRAF-1EF

UniProt

P68104

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human EEF1A1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001393

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Emerin (EDMD, EMD, Emery Dreifuss muscular dystrophy, STA)
254032 50 µL

Emerin (EDMD, EMD, Emery Dreifuss muscular dystrophy, STA)

Sign In for Pricing
View Details
Ɑ-Methoxy-ω-Hydroxy PEG
122000-0.5G 5 g

Ɑ-Methoxy-ω-Hydroxy PEG

Sign In for Pricing
View Details
EPHB1/2 antibody
70R-51798 100 µL

EPHB1/2 antibody

Sign In for Pricing
View Details
Human Low Density Lipoprotein Receptor Related Protein 6 (LRP6) ELISA Kit
MBS264312-01 48 Well

Human Low Density Lipoprotein Receptor Related Protein 6 (LRP6) ELISA Kit

Sign In for Pricing
View Details
Human Low Density Lipoprotein Receptor Related Protein 6 (LRP6) ELISA Kit
MBS264312-02 96 Well

Human Low Density Lipoprotein Receptor Related Protein 6 (LRP6) ELISA Kit

Sign In for Pricing
View Details
Human Low Density Lipoprotein Receptor Related Protein 6 (LRP6) ELISA Kit
MBS264312-03 5x 96 Well

Human Low Density Lipoprotein Receptor Related Protein 6 (LRP6) ELISA Kit

Sign In for Pricing
View Details