Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB2 Rabbit Polyclonal Antibody (HRP)

HSPB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MKBP, HSP27, Hs.78846, LOH11CR1K

UniProt

Q16082

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human HSPB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEG

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001532

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAra h 8 (Arachis hypogaea 8.0101) Antibody
orb1088512 0.1 mg

RAra h 8 (Arachis hypogaea 8.0101) Antibody

Sign In for Pricing
View Details
CF®633 Donkey Anti-Rat IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL
#20137 1x 500 µL

CF®633 Donkey Anti-Rat IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase PRT1 (PRT1)
MBS1428057-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase PRT1 (PRT1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase PRT1 (PRT1)
MBS1428057-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase PRT1 (PRT1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase PRT1 (PRT1)
MBS1428057-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase PRT1 (PRT1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase PRT1 (PRT1)
MBS1428057-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase PRT1 (PRT1)

Sign In for Pricing
View Details