Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3E Rabbit Polyclonal Antibody (FITC)

EIF3E Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

INT6, EIF3S6, EIF3-P48, eIF3-p46

UniProt

P60228

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EIF3E

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001559

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster THO Complex Subunit 4 (THOC4) ELISA Kit
MBS9362524-01 48 Well

Hamster THO Complex Subunit 4 (THOC4) ELISA Kit

Sign In for Pricing
View Details
Hamster THO Complex Subunit 4 (THOC4) ELISA Kit
MBS9362524-02 96 Well

Hamster THO Complex Subunit 4 (THOC4) ELISA Kit

Sign In for Pricing
View Details
Hamster THO Complex Subunit 4 (THOC4) ELISA Kit
MBS9362524-03 5x 96 Well

Hamster THO Complex Subunit 4 (THOC4) ELISA Kit

Sign In for Pricing
View Details
Hamster THO Complex Subunit 4 (THOC4) ELISA Kit
MBS9362524-04 10x 96 Well

Hamster THO Complex Subunit 4 (THOC4) ELISA Kit

Sign In for Pricing
View Details
GM-CSF (Csf2, Granulocyte-macrophage Colony-stimulating Factor, Colony-stimulating Factor, CSF, Csfgm, MGC151255, MGC151257) (MaxLight 405) discontinued
143577-ML405 100 µL

GM-CSF (Csf2, Granulocyte-macrophage Colony-stimulating Factor, Colony-stimulating Factor, CSF, Csfgm, MGC151255, MGC151257) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Neisseria gonorrhoeae Elongation factor P (efp)
MBS1400672-01 0.02 mg (E-Coli)

Recombinant Neisseria gonorrhoeae Elongation factor P (efp)

Sign In for Pricing
View Details