Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3E Rabbit Polyclonal Antibody (HRP)

EIF3E Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

INT6, EIF3S6, EIF3-P48, eIF3-p46

UniProt

P60228

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EIF3E

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001559

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYLK4 (Myosin Light Chain Kinase Family Member 4, Sugen Kinase 85, SgK085, MYLK4, SGK085)
406762-01 50 µL

MYLK4 (Myosin Light Chain Kinase Family Member 4, Sugen Kinase 85, SgK085, MYLK4, SGK085)

Sign In for Pricing
View Details
MYLK4 (Myosin Light Chain Kinase Family Member 4, Sugen Kinase 85, SgK085, MYLK4, SGK085)
406762-02 100 µL

MYLK4 (Myosin Light Chain Kinase Family Member 4, Sugen Kinase 85, SgK085, MYLK4, SGK085)

Sign In for Pricing
View Details
Recombinant Human VSIG4/CRIg Protein, C-His
ARO-P15604 100 µg

Recombinant Human VSIG4/CRIg Protein, C-His

Sign In for Pricing
View Details
MCJB70c Cell Line
T8140 1x106 cells / 1.0 mL

MCJB70c Cell Line

Sign In for Pricing
View Details
Recombinant Human Cortexin domain-containing 1 protein (CTXD1), partial, Biotinylated
orb3005381-01 20 µg

Recombinant Human Cortexin domain-containing 1 protein (CTXD1), partial, Biotinylated

Sign In for Pricing
View Details
Recombinant Human Cortexin domain-containing 1 protein (CTXD1), partial, Biotinylated
orb3005381-02 100 µg

Recombinant Human Cortexin domain-containing 1 protein (CTXD1), partial, Biotinylated

Sign In for Pricing
View Details