Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp5f1 Rabbit Polyclonal Antibody (HRP)

Atp5f1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Atp5, Atp5f1, C76477

UniProt

Q9CQQ7

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPLPEYGGKVRLGLIPEEFFQFLYPKTGVTGPYVLGTGLSLYFLSKEIYV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033855

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-FITC cadaverine
129-AAT 100 mg

5-FITC cadaverine

Sign In for Pricing
View Details
Human SUSD3 activation kit by CRISPRa
GA116443 1 Kit

Human SUSD3 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/799 + KRT19/800), CF568 conjugate, 0.1mg/mL
BNC681150-500 1x 500 µL

Cytokeratin 19 (KRT19/799 + KRT19/800), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRMT6 Rabbit Polyclonal Antibody
TA362824 100 µL

PRMT6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LRCOL1 Human Gene Knockout Kit (CRISPR)
KN431002 1 Kit

LRCOL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CoolCube™ Microtube and PCR Plate Cooler
R1000 1 Each

CoolCube™ Microtube and PCR Plate Cooler

Sign In for Pricing
View Details