Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENO3 Rabbit Polyclonal Antibody (HRP)

ENO3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MSE, GSD13

UniProt

P13929

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ENO3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001967

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA6, Recombinant, Human, aa1-637, His-Tag (Heat Shock 70kD Protein 6)
373701-01 20 µg

HSPA6, Recombinant, Human, aa1-637, His-Tag (Heat Shock 70kD Protein 6)

Sign In for Pricing
View Details
HSPA6, Recombinant, Human, aa1-637, His-Tag (Heat Shock 70kD Protein 6)
373701-02 100 µg

HSPA6, Recombinant, Human, aa1-637, His-Tag (Heat Shock 70kD Protein 6)

Sign In for Pricing
View Details
HSPA6, Recombinant, Human, aa1-637, His-Tag (Heat Shock 70kD Protein 6)
373701-03 1 mg

HSPA6, Recombinant, Human, aa1-637, His-Tag (Heat Shock 70kD Protein 6)

Sign In for Pricing
View Details
Lentiviral human NDUFB9 sgRNA gene knockout kit - Lentiviral human NDUFB9 sgRNA gene knockout kit (plasmid)
GTR15357932 1 Vial

Lentiviral human NDUFB9 sgRNA gene knockout kit - Lentiviral human NDUFB9 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Lentiviral human SLC13A5 shRNA (UAS) - Lentiviral human SLC13A5 shRNA (UAS, GFP) plasmid
GTR15132322 1 Vial

Lentiviral human SLC13A5 shRNA (UAS) - Lentiviral human SLC13A5 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Rat CENPI (Centromere Protein I) ValidElisa Kit
EK342687 96 Well

Rat CENPI (Centromere Protein I) ValidElisa Kit

Sign In for Pricing
View Details