Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIM Rabbit Polyclonal Antibody (HRP)

VIM Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ36605

UniProt

P08670

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human VIM

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_003371

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

11-oxo-Mogroside V
AB1663 20 mg

11-oxo-Mogroside V

Sign In for Pricing
View Details
Anti-Human FGF23 Antibody (SAA0441), FITC
FHJ53411 100 Tests

Anti-Human FGF23 Antibody (SAA0441), FITC

Sign In for Pricing
View Details
IgG2c Antibody (HRP)
orb436567 0.5 mg

IgG2c Antibody (HRP)

Sign In for Pricing
View Details
ICK (Intestinal Cell Kinase, LCK2, MRK, Serine/threonine-protein kinase ICK, Laryngeal cancer kinase 2, MAK-related kinase)
363546 200 µL

ICK (Intestinal Cell Kinase, LCK2, MRK, Serine/threonine-protein kinase ICK, Laryngeal cancer kinase 2, MAK-related kinase)

Sign In for Pricing
View Details
Lentiviral human ESRRA sgRNA gene knockout kit - Lentiviral human ESRRA sgRNA gene knockout kit (plasmid)
GTR15358319 1 Vial

Lentiviral human ESRRA sgRNA gene knockout kit - Lentiviral human ESRRA sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
LILRB1 (Leukocyte Immunoglobulin-like Receptor Subfamily B Member 1, LIR-1, Leukocyte Immunoglobulin-like Receptor 1, CD85 Antigen-like Family Member J, Immunoglobulin-like Transcript 2, ILT-2, Monocyte/Macrophage Immunoglobulin-like Receptor 7, MIR-7, CD85j, ILT2, LIR1, MIR7, FLJ37515)
129093 50 µg

LILRB1 (Leukocyte Immunoglobulin-like Receptor Subfamily B Member 1, LIR-1, Leukocyte Immunoglobulin-like Receptor 1, CD85 Antigen-like Family Member J, Immunoglobulin-like Transcript 2, ILT-2, Monocyte/Macrophage Immunoglobulin-like Receptor 7, MIR-7, CD85j, ILT2, LIR1, MIR7, FLJ37515)

Sign In for Pricing
View Details