Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCAP Rabbit Polyclonal Antibody (Biotin)

TCAP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TELE, CMD1N, CMH25, T-cap, LGMD2G, LGMDR7, telethonin

UniProt

O15273

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TCAP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IQLQELLALETALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSM

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003664

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGAP25 Mouse Monoclonal Antibody [Clone 2D5]
E45M10275V-2 50 µL

ARHGAP25 Mouse Monoclonal Antibody [Clone 2D5]

Sign In for Pricing
View Details
Bovine Carbonic Anhydrase VI ELISA Kit
OM616933 96 Strip Well

Bovine Carbonic Anhydrase VI ELISA Kit

Sign In for Pricing
View Details
Gfi1 (NM_010278) Mouse Tagged ORF Clone Lentiviral Particle
MR227196L3V 200 µL

Gfi1 (NM_010278) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PRAME Antibody
43525 100 µL

PRAME Antibody

Sign In for Pricing
View Details
TSC2, Phosphorylated (S1343) (Tsc2, Tuberin, Tuberous sclerosis 2 protein homolog) (MaxLight 750)
MBS6359318-01 0.1 mL

TSC2, Phosphorylated (S1343) (Tsc2, Tuberin, Tuberous sclerosis 2 protein homolog) (MaxLight 750)

Sign In for Pricing
View Details
TSC2, Phosphorylated (S1343) (Tsc2, Tuberin, Tuberous sclerosis 2 protein homolog) (MaxLight 750)
MBS6359318-02 5x 0.1 mL

TSC2, Phosphorylated (S1343) (Tsc2, Tuberin, Tuberous sclerosis 2 protein homolog) (MaxLight 750)

Sign In for Pricing
View Details