Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCAP Rabbit Polyclonal Antibody (HRP)

TCAP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TELE, CMD1N, CMH25, T-cap, LGMD2G, LGMDR7, telethonin

UniProt

O15273

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TCAP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IQLQELLALETALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSM

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003664

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Β-Ala-His dipeptidase (CNDP1) Human ELISA Kit
B8393 96 Tests

Β-Ala-His dipeptidase (CNDP1) Human ELISA Kit

Sign In for Pricing
View Details
Guinea pig VASPIN (Visceral Adipose Specific Serine Protease Inhibitor) ELISA Kit
MBS2514702-01 24 Tests

Guinea pig VASPIN (Visceral Adipose Specific Serine Protease Inhibitor) ELISA Kit

Sign In for Pricing
View Details
Guinea pig VASPIN (Visceral Adipose Specific Serine Protease Inhibitor) ELISA Kit
MBS2514702-02 48 Test

Guinea pig VASPIN (Visceral Adipose Specific Serine Protease Inhibitor) ELISA Kit

Sign In for Pricing
View Details
Guinea pig VASPIN (Visceral Adipose Specific Serine Protease Inhibitor) ELISA Kit
MBS2514702-03 96 Tests

Guinea pig VASPIN (Visceral Adipose Specific Serine Protease Inhibitor) ELISA Kit

Sign In for Pricing
View Details
Guinea pig VASPIN (Visceral Adipose Specific Serine Protease Inhibitor) ELISA Kit
MBS2514702-04 5x 96 Tests

Guinea pig VASPIN (Visceral Adipose Specific Serine Protease Inhibitor) ELISA Kit

Sign In for Pricing
View Details
Guinea pig VASPIN (Visceral Adipose Specific Serine Protease Inhibitor) ELISA Kit
MBS2514702-05 10x 96 Tests

Guinea pig VASPIN (Visceral Adipose Specific Serine Protease Inhibitor) ELISA Kit

Sign In for Pricing
View Details