Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX6 Rabbit Polyclonal Antibody (FITC)

PRDX6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PRX, p29, AOP2, 1-Cys, NSGPx, aiPLA2, LPCAT-5, HEL-S-128m

UniProt

P30041

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRDX6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BST2 293 Cell Lysate
401259 0.1 mg

BST2 293 Cell Lysate

Sign In for Pricing
View Details
hnRNP H CRISPR Activation Plasmid (h2)
sc-416812-ACT-2 20 µg

hnRNP H CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
T2R38 Polyclonal Antibody
BT-AP14679-01 20 µL

T2R38 Polyclonal Antibody

Sign In for Pricing
View Details
T2R38 Polyclonal Antibody
BT-AP14679-02 50 µL

T2R38 Polyclonal Antibody

Sign In for Pricing
View Details
T2R38 Polyclonal Antibody
BT-AP14679-03 100 µL

T2R38 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse Taste receptor type 2 member 106 (Tas2r106)
MBS7030885-01 0.02 mg

Recombinant Mouse Taste receptor type 2 member 106 (Tas2r106)

Sign In for Pricing
View Details