Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX6 Rabbit Polyclonal Antibody (FITC)

PRDX6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PRX, p29, AOP2, 1-Cys, NSGPx, aiPLA2, LPCAT-5, HEL-S-128m

UniProt

P30041

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRDX6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZHX1 Protein Vector (Mouse) (pPM-C-HA)
PV250740 500 ng

ZHX1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CHKB Protein Vector (Human) (pPB-C-His)
PV069361 500 ng

CHKB Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Slc22a15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3618708 1.0 µg DNA

Slc22a15 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Vmn2r18 (NM_001102582) Mouse Tagged ORF Clone
MR213976 10 µg

Vmn2r18 (NM_001102582) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Deae Cellulose 52 (For Molecular Biology)
00930 00005 5 g

Deae Cellulose 52 (For Molecular Biology)

Sign In for Pricing
View Details
BSA tracer Conventional 6-nm gold
206.033 10 mL

BSA tracer Conventional 6-nm gold

Sign In for Pricing
View Details