Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDX6 Rabbit Polyclonal Antibody (Biotin)

PRDX6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PRX, p29, AOP2, 1-Cys, NSGPx, aiPLA2, LPCAT-5, HEL-S-128m

UniProt

P30041

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PRDX6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_004896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-TAB1 antibody
SLM-60541M-01 50 µL

Mouse Anti-TAB1 antibody

Sign In for Pricing
View Details
Mouse Anti-TAB1 antibody
SLM-60541M-02 100 µL

Mouse Anti-TAB1 antibody

Sign In for Pricing
View Details
ERN2 AAV siRNA Pooled Vector
19439161 1.0 µg

ERN2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CCBP2, NT (Chemokine-binding Protein 2, Chemokine-binding Protein D6, C-C Chemokine Receptor D6, Chemokine Receptor CCR-9, CCR9, CC-Chemokine Receptor CCR-10, CCR10, CCBP2, CMKBR9) (MaxLight 750) discontinued
C2099-73R-ML750 100 µL

CCBP2, NT (Chemokine-binding Protein 2, Chemokine-binding Protein D6, C-C Chemokine Receptor D6, Chemokine Receptor CCR-9, CCR9, CC-Chemokine Receptor CCR-10, CCR10, CCBP2, CMKBR9) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Mouse Pla2g2a/Phospholipase A2, membrane associated ELISA Kit
E1148Mo 96 Tests

Mouse Pla2g2a/Phospholipase A2, membrane associated ELISA Kit

Sign In for Pricing
View Details
RasGRP1 HDR Plasmid (h)
sc-402120-HDR 20 µg

RasGRP1 HDR Plasmid (h)

Sign In for Pricing
View Details