Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPD52 Rabbit Polyclonal Antibody (FITC)

TPD52 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

D52, N8L, PC-1, PrLZ, hD52

UniProt

P55327

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TPD52

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001020423

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey CCL4L1 (Chemokine C-C-Motif Ligand 4 Like Protein 1) ELISA Kit
MBS2506148-01 24 Tests

Monkey CCL4L1 (Chemokine C-C-Motif Ligand 4 Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
Monkey CCL4L1 (Chemokine C-C-Motif Ligand 4 Like Protein 1) ELISA Kit
MBS2506148-02 48 Tests

Monkey CCL4L1 (Chemokine C-C-Motif Ligand 4 Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
Monkey CCL4L1 (Chemokine C-C-Motif Ligand 4 Like Protein 1) ELISA Kit
MBS2506148-03 96 Tests

Monkey CCL4L1 (Chemokine C-C-Motif Ligand 4 Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
Monkey CCL4L1 (Chemokine C-C-Motif Ligand 4 Like Protein 1) ELISA Kit
MBS2506148-04 5x 96 Tests

Monkey CCL4L1 (Chemokine C-C-Motif Ligand 4 Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
Monkey CCL4L1 (Chemokine C-C-Motif Ligand 4 Like Protein 1) ELISA Kit
MBS2506148-05 10x 96 Tests

Monkey CCL4L1 (Chemokine C-C-Motif Ligand 4 Like Protein 1) ELISA Kit

Sign In for Pricing
View Details
CASP8, CT (Caspase-8, CASP-8, ICE-like Apoptotic Protease 5, MORT1-associated CED-3 Homolog, MACH, FADD-homologous ICE/CED-3-like Protease, FADD-like ICE, FLICE, Apoptotic Cysteine Protease, Apoptotic Protease Mch-5, CAP4, Caspase-8 Subunit p18, Caspase-8
MBS644805-01 0.2 mL

CASP8, CT (Caspase-8, CASP-8, ICE-like Apoptotic Protease 5, MORT1-associated CED-3 Homolog, MACH, FADD-homologous ICE/CED-3-like Protease, FADD-like ICE, FLICE, Apoptotic Cysteine Protease, Apoptotic Protease Mch-5, CAP4, Caspase-8 Subunit p18, Caspase-8

Sign In for Pricing
View Details