Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp5c1 Rabbit Polyclonal Antibody (Biotin)

Atp5c1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Atp5f1c, 1700094F02Rik

UniProt

Q91VR2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Atp5c1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065640

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IL24 (Interleukin 24) ELISA Kit
MBS8805693-01 48 Well

Rat IL24 (Interleukin 24) ELISA Kit

Sign In for Pricing
View Details
Rat IL24 (Interleukin 24) ELISA Kit
MBS8805693-02 96 Well

Rat IL24 (Interleukin 24) ELISA Kit

Sign In for Pricing
View Details
Rat IL24 (Interleukin 24) ELISA Kit
MBS8805693-03 5x 96 Well

Rat IL24 (Interleukin 24) ELISA Kit

Sign In for Pricing
View Details
Rat IL24 (Interleukin 24) ELISA Kit
MBS8805693-04 10x 96 Well

Rat IL24 (Interleukin 24) ELISA Kit

Sign In for Pricing
View Details
CCL27, CT (CCL27, ILC, SCYA27, C-C motif chemokine 27, CC chemokine ILC, Cutaneous T-cell-attracting chemokine, ESkine, IL-11 R-alpha-locus chemokine, Skinkine, Small-inducible cytokine A27) (MaxLight 650) discontinued
033367-ML650 100 µL

CCL27, CT (CCL27, ILC, SCYA27, C-C motif chemokine 27, CC chemokine ILC, Cutaneous T-cell-attracting chemokine, ESkine, IL-11 R-alpha-locus chemokine, Skinkine, Small-inducible cytokine A27) (MaxLight 650) discontinued

Sign In for Pricing
View Details
CD30 Rabbit Polyclonal Antibody (HRP)
orb110079 100 µL

CD30 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details