Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp5c1 Rabbit Polyclonal Antibody (HRP)

Atp5c1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Atp5f1c, 1700094F02Rik

UniProt

Q91VR2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Atp5c1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARVYGT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065640

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Omentum
CS804265 5x 5 µm

Tissue FFPE Sections, Omentum

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: right
CS711279 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details
RFXANK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E7]
TA504271AM 100 µL

RFXANK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E7]

Sign In for Pricing
View Details
TTDN1 (MPLKIP) Human Gene Knockout Kit (CRISPR)
KN204767LP 1 Kit

TTDN1 (MPLKIP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CT45A4 (NM_001017436) Human Over-expression Lysate
LC422733 20 µg

CT45A4 (NM_001017436) Human Over-expression Lysate

Sign In for Pricing
View Details
Cube Ice Maker BICU-112
BICU-112 Each

Cube Ice Maker BICU-112

Sign In for Pricing
View Details