Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNB2 Rabbit Polyclonal Antibody (FITC)

GNB2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P62879

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GNB2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005264

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey P53 Upregulated Modulator Of Apoptosis ELISA Kit
MBS744227-01 48 Well

Monkey P53 Upregulated Modulator Of Apoptosis ELISA Kit

Sign In for Pricing
View Details
Monkey P53 Upregulated Modulator Of Apoptosis ELISA Kit
MBS744227-02 96 Well

Monkey P53 Upregulated Modulator Of Apoptosis ELISA Kit

Sign In for Pricing
View Details
Monkey P53 Upregulated Modulator Of Apoptosis ELISA Kit
MBS744227-03 5x 96 Well

Monkey P53 Upregulated Modulator Of Apoptosis ELISA Kit

Sign In for Pricing
View Details
Monkey P53 Upregulated Modulator Of Apoptosis ELISA Kit
MBS744227-04 10x 96 Well

Monkey P53 Upregulated Modulator Of Apoptosis ELISA Kit

Sign In for Pricing
View Details
DENND2D Protein Vector (Mouse) (pPM-C-HA)
PV171660 500 ng

DENND2D Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
FITC-linked Antibody to Hexokinase 2 (HK2)
MBS2014406-01 0.1 mL

FITC-linked Antibody to Hexokinase 2 (HK2)

Sign In for Pricing
View Details