Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus NL63 Membrane protein (M)

Product Specifications

Product Name Alternative

E1 glycoprotein Matrix glycoprotein Membrane glycoprotein

Abbreviation

Recombinant Human coronavirus NL63 Membrane protein

Gene Name

M

UniProt

Q6Q1R9

Expression Region

1-226aa

Organism

Human coronavirus NL63 (HCoV-NL63)

Target Sequence

MSNSSVPLLEVYVHLRNWNFSWNLILTLFIVVLQYGHYKYSRLLYGLKMSVLWCLWPLVLALSIFDCFVNFNVDWVFFGFSILMSIITLCLWVMYFVNSFRLWRRVKTFWAFNPETNAIISLQVYGHNYYLPVMAAPTGVTLTLLSGVLLVDGHKIATRVQVGQLPKYVIVATPSTTIVCDRVGRSVNETSQTGWAFYVRAKHGDFSGVASQEGVLSEREKLLHLI

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & In Stock Protein & Coronavirus Protein

Source

In vitro E.coli expression system

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Big Endothelin, Big ET GENLISA ELISA
KLM0035 96 Well

Mouse Big Endothelin, Big ET GENLISA ELISA

Sign In for Pricing
View Details
TNNC2 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2483115 100 µL

TNNC2 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Human EGFR/ERBB1/HER1 Antibody , PerCP
E55A09017 50 Tests

Human EGFR/ERBB1/HER1 Antibody , PerCP

Sign In for Pricing
View Details
HPV16 E7 (TVG710Y) Alexa Fluor® 790
sc-264 AF790 200 µg/mL

HPV16 E7 (TVG710Y) Alexa Fluor® 790

Sign In for Pricing
View Details
MAP4K2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV621470 1.0 µg DNA

MAP4K2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
SLC25A24 Protein Vector (Mouse) (pPB-C-His)
PV230190 500 ng

SLC25A24 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details