Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mdh1 Rabbit Polyclonal Antibody (FITC)

Mdh1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Mo, Mor, MDH-, MDHA, Mor2, MDH-s, Mor-2, D17921, B230377B03Rik

UniProt

P14152

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Mdh1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIAT

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032644

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR1 (NM_023110) Human Mutant ORF Clone
RC403385 10 µg

FGFR1 (NM_023110) Human Mutant ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal TMIGD2 Antibody (953730) - Azide Free
MAB83161-SP 25 µg

Mouse Monoclonal TMIGD2 Antibody (953730) - Azide Free

Sign In for Pricing
View Details
Mobkl2c sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3471705 3x 1.0 µg

Mobkl2c sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
KRT35 Mouse Monoclonal Antibody [Clone ID: OTI1A4]
TA811831S 30 µL

KRT35 Mouse Monoclonal Antibody [Clone ID: OTI1A4]

Sign In for Pricing
View Details
Recombinant Rabbit TNF a Protein, Untagged, E.coli-1mg
QP10882-1mg 1mg

Recombinant Rabbit TNF a Protein, Untagged, E.coli-1mg

Sign In for Pricing
View Details
Estrogen Receptor α Polyclonal Antibody
RA24723-01 50 µL

Estrogen Receptor α Polyclonal Antibody

Sign In for Pricing
View Details