Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mdh1 Rabbit Polyclonal Antibody (HRP)

Mdh1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mo, Mor, MDH-, MDHA, Mor2, MDH-s, Mor-2, D17921, B230377B03Rik

UniProt

P14152

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Mdh1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIAT

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032644

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCR 8-strip dome caps, PP, natural, no tubes
PCR-02DC 125/Box

PCR 8-strip dome caps, PP, natural, no tubes

Sign In for Pricing
View Details
YeaY Antibody
orb829672 2 mg

YeaY Antibody

Sign In for Pricing
View Details
Biochanin A
N1308-5.1 10 mM (in 1mL DMSO)

Biochanin A

Sign In for Pricing
View Details
KD-Validated Anti-Phosphoglycerate Kinase 1 Mouse Monoclonal Antibody
AGI1789-100 100 µL

KD-Validated Anti-Phosphoglycerate Kinase 1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Chromogenic E. coli Agar 10 x 90 mm Petri
TMB_CEC_P90_10 10 x 90 mm Petri

Chromogenic E. coli Agar 10 x 90 mm Petri

Sign In for Pricing
View Details
Recombinant 5'-Nucleotidase, Mitochondrial (NT5M)
TRV-0054232-01 10 µg

Recombinant 5'-Nucleotidase, Mitochondrial (NT5M)

Sign In for Pricing
View Details