Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDH1 Rabbit Polyclonal Antibody (HRP)

MDH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KAR, MDHA, MOR2, DEE88, MDH-s, EIEE88, HEL-S-32, MGC:1375

UniProt

P40925

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MDH1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005908

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WIPI2 (WD Repeat Domain, Phosphoinositide Interacting 2) (APC) discontinued
215211-APC 100 µL

WIPI2 (WD Repeat Domain, Phosphoinositide Interacting 2) (APC) discontinued

Sign In for Pricing
View Details
Licochalcone A
N2417-20 20 mg

Licochalcone A

Sign In for Pricing
View Details
Adrenergic Receptor beta2 (Phospho-Ser346) Antibody
MBS9502884-01 0.05 mL

Adrenergic Receptor beta2 (Phospho-Ser346) Antibody

Sign In for Pricing
View Details
Adrenergic Receptor beta2 (Phospho-Ser346) Antibody
MBS9502884-02 0.1 mL

Adrenergic Receptor beta2 (Phospho-Ser346) Antibody

Sign In for Pricing
View Details
Adrenergic Receptor beta2 (Phospho-Ser346) Antibody
MBS9502884-03 5x 0.1 mL

Adrenergic Receptor beta2 (Phospho-Ser346) Antibody

Sign In for Pricing
View Details
Phospho-AKT1 (Tyr474) Rabbit Polyclonal Antibody (RBITC)
orb1011243 100 µL

Phospho-AKT1 (Tyr474) Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details