Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDH1 Rabbit Polyclonal Antibody (HRP)

MDH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KAR, MDHA, MOR2, DEE88, MDH-s, EIEE88, HEL-S-32, MGC:1375

UniProt

P40925

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MDH1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005908

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Lipoprteinlipase ELISA Kit
MBS735664-01 48 Well

Monkey Lipoprteinlipase ELISA Kit

Sign In for Pricing
View Details
Monkey Lipoprteinlipase ELISA Kit
MBS735664-02 96 Well

Monkey Lipoprteinlipase ELISA Kit

Sign In for Pricing
View Details
Monkey Lipoprteinlipase ELISA Kit
MBS735664-03 5x 96 Well

Monkey Lipoprteinlipase ELISA Kit

Sign In for Pricing
View Details
Monkey Lipoprteinlipase ELISA Kit
MBS735664-04 10x 96 Well

Monkey Lipoprteinlipase ELISA Kit

Sign In for Pricing
View Details
UIMC1 Recombinant Protein (Mouse)
RP183074 100 µg

UIMC1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Sheep Cerebellar degeneion-related protein 2 (CDR2) ELISA Kit
MBS7252118-01 48 Well

Sheep Cerebellar degeneion-related protein 2 (CDR2) ELISA Kit

Sign In for Pricing
View Details