Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MDH2 Rabbit Polyclonal Antibody (HRP)

MDH2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MDH, MOR1, DEE51, M-MDH, EIEE51, MGC:3559

UniProt

P40926

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MDH2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005909

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proteasome 19S 10B Rabbit Polyclonal Antibody (APC)
orb1008986 100 µL

Proteasome 19S 10B Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Tetrabutylammonium hydrogen sulfate
GK0881-250g 250 g

Tetrabutylammonium hydrogen sulfate

Sign In for Pricing
View Details
C-X-C Motif Chemokine 10 (CXCL10) Antibody (PerCP)
abx422704-01 50 Tests

C-X-C Motif Chemokine 10 (CXCL10) Antibody (PerCP)

Sign In for Pricing
View Details
C-X-C Motif Chemokine 10 (CXCL10) Antibody (PerCP)
abx422704-02 100 Tests

C-X-C Motif Chemokine 10 (CXCL10) Antibody (PerCP)

Sign In for Pricing
View Details
Matrix metalloproteinase-24 MMP24/24 Rabbit Polyclonal Antibody (APC)
orb2574699 100 µg

Matrix metalloproteinase-24 MMP24/24 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
FADS1 (Fatty Acid Desaturase 1, Delta(5) Fatty Acid Desaturase, D5D, Delta(5) Desaturase, Delta-5 Desaturase, FADSD5, FLJ38956, FLJ90273) APC
MBS6377977-01 0.1 mL

FADS1 (Fatty Acid Desaturase 1, Delta(5) Fatty Acid Desaturase, D5D, Delta(5) Desaturase, Delta-5 Desaturase, FADSD5, FLJ38956, FLJ90273) APC

Sign In for Pricing
View Details