Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAA2 Rabbit Polyclonal Antibody (FITC)

ACAA2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DSAEC

UniProt

P42765

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ACAA2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006102

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-DAXX (Ser495) Rabbit pAb, PerCP-Cy7 conjugated
orb2863079 100 µL

Phospho-DAXX (Ser495) Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Recombinant Human cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A (PDE10), partial
orb3011084-01 20 µg

Recombinant Human cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A (PDE10), partial

Sign In for Pricing
View Details
Recombinant Human cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A (PDE10), partial
orb3011084-02 100 µg

Recombinant Human cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A (PDE10), partial

Sign In for Pricing
View Details
Recombinant Human cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A (PDE10), partial
orb3011084-03 1 mg

Recombinant Human cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A (PDE10), partial

Sign In for Pricing
View Details
CCDC64 Polyclonal Antibody, Cy5 Conjugated
bs-13808R-Cy5 100 µL

CCDC64 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
IGHV4-55 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV764386 1.0 µg DNA

IGHV4-55 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details