Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACAA2 Rabbit Polyclonal Antibody (HRP)

ACAA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DSAEC

UniProt

P42765

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ACAA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006102

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granulin Rabbit Polyclonal Antibody (BF350)
orb2556071 100 µL

Granulin Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
CREB3 (Basic Leucine Zipper Protein, LZIP, LUMAN) (MaxLight 550)
MBS6445883-01 0.1 mL

CREB3 (Basic Leucine Zipper Protein, LZIP, LUMAN) (MaxLight 550)

Sign In for Pricing
View Details
CREB3 (Basic Leucine Zipper Protein, LZIP, LUMAN) (MaxLight 550)
MBS6445883-02 5x 0.1 mL

CREB3 (Basic Leucine Zipper Protein, LZIP, LUMAN) (MaxLight 550)

Sign In for Pricing
View Details
ZNF503 Rabbit Polyclonal Antibody (BF488)
orb2523323 100 µL

ZNF503 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
PRDM16 (PR Domain Zinc Finger Protein 16, PR Domain-Containing Protein 16, Transcription Factor MEL1, MDS1/EVI1-like gene 1, PRDM16, KIAA1675, MEL1, PFM13) (HRP)
MBS6458432-01 0.2 mL

PRDM16 (PR Domain Zinc Finger Protein 16, PR Domain-Containing Protein 16, Transcription Factor MEL1, MDS1/EVI1-like gene 1, PRDM16, KIAA1675, MEL1, PFM13) (HRP)

Sign In for Pricing
View Details
PRDM16 (PR Domain Zinc Finger Protein 16, PR Domain-Containing Protein 16, Transcription Factor MEL1, MDS1/EVI1-like gene 1, PRDM16, KIAA1675, MEL1, PFM13) (HRP)
MBS6458432-02 5x 0.2 mL

PRDM16 (PR Domain Zinc Finger Protein 16, PR Domain-Containing Protein 16, Transcription Factor MEL1, MDS1/EVI1-like gene 1, PRDM16, KIAA1675, MEL1, PFM13) (HRP)

Sign In for Pricing
View Details