Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DSTN Rabbit Polyclonal Antibody (FITC)

DSTN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ADF, ACTDP, HEL32, bA462D18.2

UniProt

P60981

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DSTN

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEE

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_006861

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD152 (CTLA4, Cytolytic T-lymphocyte-associated Antigen 4)
C2548-83K 200 µg

CD152 (CTLA4, Cytolytic T-lymphocyte-associated Antigen 4)

Sign In for Pricing
View Details
Lentiviral human FOXA2 shRNA (UAS) - Lentiviral human FOXA2 shRNA (UAS, RFP) plasmid
GTR15098737 1 Vial

Lentiviral human FOXA2 shRNA (UAS) - Lentiviral human FOXA2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Cytidylate kinase (cmk)
MBS1133519-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O157:H7 Cytidylate kinase (cmk)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Cytidylate kinase (cmk)
MBS1133519-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O157:H7 Cytidylate kinase (cmk)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Cytidylate kinase (cmk)
MBS1133519-03 0.02 mg (Yeast)

Recombinant Escherichia coli O157:H7 Cytidylate kinase (cmk)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Cytidylate kinase (cmk)
MBS1133519-04 0.1 mg (Yeast)

Recombinant Escherichia coli O157:H7 Cytidylate kinase (cmk)

Sign In for Pricing
View Details