Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRUB2 Rabbit Polyclonal Antibody (HRP)

TRUB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CLONE24922

UniProt

O95900

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRUB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056494

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Alanine glyoxylate aminotransferase 2 like 2 (AGXT2L2) ELISA kit
GTR10447716 96 Well

Rabbit Alanine glyoxylate aminotransferase 2 like 2 (AGXT2L2) ELISA kit

Sign In for Pricing
View Details
NADP Malic Enzyme (NADP-ME) Activity Assay Kit
AK0485-100T-96S 100 Tests - 96 Samples

NADP Malic Enzyme (NADP-ME) Activity Assay Kit

Sign In for Pricing
View Details
Dichloroindophenol (Standard)
HY-W020729R Inquire

Dichloroindophenol (Standard)

Sign In for Pricing
View Details
PRDM12 AAV Vector (Human) (CMV)
37569101 1 µg

PRDM12 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
OR6K2, CT (OR6K2, Olfactory receptor 6K2, Olfactory receptor OR1-17) (MaxLight 405) discontinued
039470-ML405 100 µL

OR6K2, CT (OR6K2, Olfactory receptor 6K2, Olfactory receptor OR1-17) (MaxLight 405) discontinued

Sign In for Pricing
View Details
RAB40C Blocking Peptide
33R-7497 0.1 mg

RAB40C Blocking Peptide

Sign In for Pricing
View Details