Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIZ Rabbit Polyclonal Antibody (Biotin)

KIZ Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RP69, HT013, Kizuna, PLK1S1, C20orf19, NCRNA00153

UniProt

Q2M2Z5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C20orf19

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SRHENKKKPVINLKSNALWDESDDSNSEIEAALRPRNHNTDDSDDFYD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_060944

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

BATF (Basic Leucine Zipper Transcriptional Factor ATF-like, B Cell-activating Transcription Factor, SF-HT-activated Gene 2 Protein) (HRP)
MBS6151397-01 0.1 mL

BATF (Basic Leucine Zipper Transcriptional Factor ATF-like, B Cell-activating Transcription Factor, SF-HT-activated Gene 2 Protein) (HRP)

Sign In for Pricing
View Details
BATF (Basic Leucine Zipper Transcriptional Factor ATF-like, B Cell-activating Transcription Factor, SF-HT-activated Gene 2 Protein) (HRP)
MBS6151397-02 5x 0.1 mL

BATF (Basic Leucine Zipper Transcriptional Factor ATF-like, B Cell-activating Transcription Factor, SF-HT-activated Gene 2 Protein) (HRP)

Sign In for Pricing
View Details
Cullin 3 Polyclonal Antibody
E-AB-93153-01 60 µL

Cullin 3 Polyclonal Antibody

Sign In for Pricing
View Details
Cullin 3 Polyclonal Antibody
E-AB-93153-02 120 µL

Cullin 3 Polyclonal Antibody

Sign In for Pricing
View Details
Cullin 3 Polyclonal Antibody
E-AB-93153-03 200 µL

Cullin 3 Polyclonal Antibody

Sign In for Pricing
View Details
Ctsz (NM_183330) Rat Tagged Lenti ORF Clone
RR211298L3 10 µg

Ctsz (NM_183330) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details