Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GGACT, Human (HEK293, His)

The GGACT protein uses its enzymatic activity to break cross-links between lysine and glutamate residues, actively promoting the degradation of proteins cross-linked by transglutaminase. In addition, GGACT catalyzes the formation of 5-oxo-L-proline from the substrate L-γ-glutamyl-L-ε-lysine. GGACT Protein, Human (HEK293, His) is the recombinant human-derived GGACT protein, expressed by HEK293 , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

GGACT Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ggact-protein-human-hek-293-his.html

Smiles

MALVFVYGTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR

Molecular Formula

87769 (Gene_ID) Q9BVM4 (M1-R153) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-500 1x 500 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL
BNC470633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-100 1x 100 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-500 1x 500 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-500 1x 500 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF647 conjugate, 0.1mg/mL
BNC472984-100 1x 100 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details