Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM113A Rabbit Polyclonal Antibody (HRP)

FAM113A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FAM113A, C20orf81, bA12M19.1

UniProt

Q9H1Q7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM113A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLLLQKDSLLTAAQLKAKGELSFEQDQLVAGGQLGELHNGTQYREVRQFC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_073597

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NNMT Human Gene Knockout Kit (CRISPR)
KN200641BN 1 Kit

NNMT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD11b / MAC-1 (Microglial Marker) (ITGAM/3340), CF405S conjugate, 0.1mg/mL
BNC043340-500 1x 500 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3340), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SPANX (SPANXC) Rabbit Polyclonal Antibody
AP07638PU-N 50 µg

SPANX (SPANXC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Apolipoprotein E (APOE) Human Gene Knockout Kit (CRISPR)
KN200395 1 Kit

Apolipoprotein E (APOE) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant SV2A Monoclonal Antibody
AN301990L-01 50 µL

Recombinant SV2A Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SV2A Monoclonal Antibody
AN301990L-02 100 µL

Recombinant SV2A Monoclonal Antibody

Sign In for Pricing
View Details