Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THOC6 Rabbit Polyclonal Antibody (FITC)

THOC6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

WDR58, fSAP35

UniProt

Q86W42

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human THOC6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077315

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Mouse IgM mu chain - Cy3
orb1786449-01 100 µL

Goat Anti-Mouse IgM mu chain - Cy3

Sign In for Pricing
View Details
Goat Anti-Mouse IgM mu chain - Cy3
orb1786449-02 500 µL

Goat Anti-Mouse IgM mu chain - Cy3

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative F-box protein At1g20657 (At1g20657)
MBS1440350-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Putative F-box protein At1g20657 (At1g20657)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative F-box protein At1g20657 (At1g20657)
MBS1440350-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Putative F-box protein At1g20657 (At1g20657)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative F-box protein At1g20657 (At1g20657)
MBS1440350-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Putative F-box protein At1g20657 (At1g20657)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative F-box protein At1g20657 (At1g20657)
MBS1440350-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Putative F-box protein At1g20657 (At1g20657)

Sign In for Pricing
View Details