Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eepd1 Rabbit Polyclonal Antibody (HRP)

Eepd1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI481005, 2310005P05Rik

UniProt

Q3TGW2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGSTLGCHRSIPRDPSDLSHNRKFSAACNFSNILVNQERLNINTATEEEL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_080465

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B9D1 Lentiviral Activation Particles (h2)
sc-411953-LAC-2 200 µL

B9D1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Gm813 (NM_001033404) Mouse Tagged ORF Clone Lentiviral Particle
MR212854L4V 200 µL

Gm813 (NM_001033404) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Thermococcus onnurineus Isopentenyl-diphosphate delta-isomerase (fni)
MBS1036292-01 0.02 mg (E-Coli)

Recombinant Thermococcus onnurineus Isopentenyl-diphosphate delta-isomerase (fni)

Sign In for Pricing
View Details
Recombinant Thermococcus onnurineus Isopentenyl-diphosphate delta-isomerase (fni)
MBS1036292-02 0.02 mg (Yeast)

Recombinant Thermococcus onnurineus Isopentenyl-diphosphate delta-isomerase (fni)

Sign In for Pricing
View Details
Recombinant Thermococcus onnurineus Isopentenyl-diphosphate delta-isomerase (fni)
MBS1036292-03 0.1 mg (E-Coli)

Recombinant Thermococcus onnurineus Isopentenyl-diphosphate delta-isomerase (fni)

Sign In for Pricing
View Details
Recombinant Thermococcus onnurineus Isopentenyl-diphosphate delta-isomerase (fni)
MBS1036292-04 0.1 mg (Yeast)

Recombinant Thermococcus onnurineus Isopentenyl-diphosphate delta-isomerase (fni)

Sign In for Pricing
View Details