Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ankrd13c Rabbit Polyclonal Antibody (Biotin)

Ankrd13c Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AI505652, AU022220

UniProt

Q3UX43

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ankrd13c

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EQSFEPVRRQSLTPPPQNTITWEEYISAENGKAPHLGRELVCKESKKTFK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001013828

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP1 mouse monoclonal antibody, clone 839120, Purified
AM33417PU-N 100 µL

PARP1 mouse monoclonal antibody, clone 839120, Purified

Sign In for Pricing
View Details
C6orf124 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0247005 3x 1.0 µg

C6orf124 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant HAdV-3 L3/CP-H/Protein II Protein, N-His
AP97299 50 µg

Recombinant HAdV-3 L3/CP-H/Protein II Protein, N-His

Sign In for Pricing
View Details
Dyskerin Lentiviral Activation Particles (m2)
sc-434137-LAC-2 200 µL

Dyskerin Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
MRC5 2nd Generation Antigen Concentrate, Elisa
F1093X ~100 μg/ mL, 200 μL

MRC5 2nd Generation Antigen Concentrate, Elisa

Sign In for Pricing
View Details
SPINT4 Protein Vector (Mouse) (pPB-N-His)
PV233451 500 ng

SPINT4 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details