Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPSTI1 Rabbit Polyclonal Antibody (Biotin)

EPSTI1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BRESI1

UniProt

Q96J88

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EPSTI1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001002264

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CEP57 Pre-designed siRNA Set B
SI002847B 1 Each

Human CEP57 Pre-designed siRNA Set B

Sign In for Pricing
View Details
TFB4 Antibody
orb852009 2 mg

TFB4 Antibody

Sign In for Pricing
View Details
IARS (Isoleucyl-tRNA Synthetase Cytoplasmic, IARS1, IleRS, ILRS, IRS, Isoleucine-tRNA Ligase) (MaxLight 550)
MBS6209748-01 0.1 mL

IARS (Isoleucyl-tRNA Synthetase Cytoplasmic, IARS1, IleRS, ILRS, IRS, Isoleucine-tRNA Ligase) (MaxLight 550)

Sign In for Pricing
View Details
IARS (Isoleucyl-tRNA Synthetase Cytoplasmic, IARS1, IleRS, ILRS, IRS, Isoleucine-tRNA Ligase) (MaxLight 550)
MBS6209748-02 5x 0.1 mL

IARS (Isoleucyl-tRNA Synthetase Cytoplasmic, IARS1, IleRS, ILRS, IRS, Isoleucine-tRNA Ligase) (MaxLight 550)

Sign In for Pricing
View Details
POU2AF1, NT (POU2AF1, OBF1, POU domain class 2-associating factor 1, B Cell-specific coactivator OBF-1, BOB-1, OCA-B, OCT-binding factor 1) (MaxLight 650)
MBS6335969-01 0.1 mL

POU2AF1, NT (POU2AF1, OBF1, POU domain class 2-associating factor 1, B Cell-specific coactivator OBF-1, BOB-1, OCA-B, OCT-binding factor 1) (MaxLight 650)

Sign In for Pricing
View Details
POU2AF1, NT (POU2AF1, OBF1, POU domain class 2-associating factor 1, B Cell-specific coactivator OBF-1, BOB-1, OCA-B, OCT-binding factor 1) (MaxLight 650)
MBS6335969-02 5x 0.1 mL

POU2AF1, NT (POU2AF1, OBF1, POU domain class 2-associating factor 1, B Cell-specific coactivator OBF-1, BOB-1, OCA-B, OCT-binding factor 1) (MaxLight 650)

Sign In for Pricing
View Details