Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPSTI1 Rabbit Polyclonal Antibody (FITC)

EPSTI1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BRESI1

UniProt

Q96J88

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EPSTI1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001002264

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-EGFP-LSAMP (human) -SV40-Neo
BZ47036 1 Vial

PCMV-EGFP-LSAMP (human) -SV40-Neo

Sign In for Pricing
View Details
LRWD1, NT (LRWD1, ORCA, Leucine-rich repeat and WD repeat-containing protein 1, ORC-associated protein, Origin recognition complex-associated protein) (MaxLight 550) discontinued
037990-ML550 100 µL

LRWD1, NT (LRWD1, ORCA, Leucine-rich repeat and WD repeat-containing protein 1, ORC-associated protein, Origin recognition complex-associated protein) (MaxLight 550) discontinued

Sign In for Pricing
View Details
PCDH10 (Protocadherin 10, DKFZp761O2023, KIAA1400, MGC133344, OL-PCDH, PCDH19) (MaxLight 650)
249826-ML650 100 µL

PCDH10 (Protocadherin 10, DKFZp761O2023, KIAA1400, MGC133344, OL-PCDH, PCDH19) (MaxLight 650)

Sign In for Pricing
View Details
Alpha-Synuclein Antibody
R33188-100UG 100 µg

Alpha-Synuclein Antibody

Sign In for Pricing
View Details
SF3B3 (Splicing Factor 3B Subunit 3, RSE1, SAP130, SF3b130, STAF130, Spliceosome-associated protein 130, Pre-mRNA-splicing factor SF3b 130kD subunit)
365029 200 µL

SF3B3 (Splicing Factor 3B Subunit 3, RSE1, SAP130, SF3b130, STAF130, Spliceosome-associated protein 130, Pre-mRNA-splicing factor SF3b 130kD subunit)

Sign In for Pricing
View Details
YGL088W Antibody
orb853120 2 mg

YGL088W Antibody

Sign In for Pricing
View Details