Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPSTI1 Rabbit Polyclonal Antibody (HRP)

EPSTI1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BRESI1

UniProt

Q96J88

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EPSTI1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001002264

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Goat Anti-CYP17A1 Antibody
AMM04949G 0.1 mg

Polyclonal Goat Anti-CYP17A1 Antibody

Sign In for Pricing
View Details
Bovine Chloride channel protein 2 (CLCN2) ELISA Kit
MBS7217930-01 48 Well

Bovine Chloride channel protein 2 (CLCN2) ELISA Kit

Sign In for Pricing
View Details
Bovine Chloride channel protein 2 (CLCN2) ELISA Kit
MBS7217930-02 96 Well

Bovine Chloride channel protein 2 (CLCN2) ELISA Kit

Sign In for Pricing
View Details
Bovine Chloride channel protein 2 (CLCN2) ELISA Kit
MBS7217930-03 5x 96 Well

Bovine Chloride channel protein 2 (CLCN2) ELISA Kit

Sign In for Pricing
View Details
Bovine Chloride channel protein 2 (CLCN2) ELISA Kit
MBS7217930-04 10x 96 Well

Bovine Chloride channel protein 2 (CLCN2) ELISA Kit

Sign In for Pricing
View Details
TNF alpha Polyclonal Antibody, PE Conjugated
bs-0078R-PE 100 µL

TNF alpha Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details