Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cfl2 Rabbit Polyclonal Antibody (FITC)

Cfl2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P45591

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Cfl2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEK

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031714

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse RAPSN (Receptor Associated Protein Of The Synapse) ELISA Kit
MBS8806213-01 48 Well

Mouse RAPSN (Receptor Associated Protein Of The Synapse) ELISA Kit

Sign In for Pricing
View Details
Mouse RAPSN (Receptor Associated Protein Of The Synapse) ELISA Kit
MBS8806213-02 96 Well

Mouse RAPSN (Receptor Associated Protein Of The Synapse) ELISA Kit

Sign In for Pricing
View Details
Mouse RAPSN (Receptor Associated Protein Of The Synapse) ELISA Kit
MBS8806213-03 5x 96 Well

Mouse RAPSN (Receptor Associated Protein Of The Synapse) ELISA Kit

Sign In for Pricing
View Details
Mouse RAPSN (Receptor Associated Protein Of The Synapse) ELISA Kit
MBS8806213-04 10x 96 Well

Mouse RAPSN (Receptor Associated Protein Of The Synapse) ELISA Kit

Sign In for Pricing
View Details
CD98 (SLC3A2) (NM_001012662) Human Recombinant Protein
TP720445XL 1 mg

CD98 (SLC3A2) (NM_001012662) Human Recombinant Protein

Sign In for Pricing
View Details
Apoptosis-inducing Factor 2 (AIFM2) Mouse ELISA Kit
B6315 96 Tests

Apoptosis-inducing Factor 2 (AIFM2) Mouse ELISA Kit

Sign In for Pricing
View Details