Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB6 Rabbit Polyclonal Antibody (FITC)

HSPB6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HEL55, Hsp20, PPP1R91

UniProt

O14558

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HSPB6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_653218

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK-3α Rabbit mAb
C05271-100uL*2 2x 100μL

GSK-3α Rabbit mAb

Sign In for Pricing
View Details
Cystatin-C Human (Cystatin C Human)
PT_40350-01 20 µg

Cystatin-C Human (Cystatin C Human)

Sign In for Pricing
View Details
Cystatin-C Human (Cystatin C Human)
PT_40350-02 100 µg

Cystatin-C Human (Cystatin C Human)

Sign In for Pricing
View Details
Cystatin-C Human (Cystatin C Human)
PT_40350-03 1 mg

Cystatin-C Human (Cystatin C Human)

Sign In for Pricing
View Details
Lentiviral human SYNJ1 sgRNA gene knockout kit - Lentiviral human SYNJ1 sgRNA gene knockout kit (25)
GTR15367554 1 Vial

Lentiviral human SYNJ1 sgRNA gene knockout kit - Lentiviral human SYNJ1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
FTSJ1 Knockout AGS Polyclonal Cells
ARG3162 1 Million

FTSJ1 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details