Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB6 Rabbit Polyclonal Antibody (HRP)

HSPB6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HEL55, Hsp20, PPP1R91

UniProt

O14558

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HSPB6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_653218

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLA2G1B (Phospholipase A2, Group IB (pancreas), MGC119834, MGC119835, PLA2, PLA2A, PPLA2) (MaxLight 405)
MBS6197280-01 0.1 mL

PLA2G1B (Phospholipase A2, Group IB (pancreas), MGC119834, MGC119835, PLA2, PLA2A, PPLA2) (MaxLight 405)

Sign In for Pricing
View Details
PLA2G1B (Phospholipase A2, Group IB (pancreas), MGC119834, MGC119835, PLA2, PLA2A, PPLA2) (MaxLight 405)
MBS6197280-02 5x 0.1 mL

PLA2G1B (Phospholipase A2, Group IB (pancreas), MGC119834, MGC119835, PLA2, PLA2A, PPLA2) (MaxLight 405)

Sign In for Pricing
View Details
Retinoid X Receptor alpha/RXRA Rabbit Polyclonal Antibody (HRP)
orb2612847 100 µg

Retinoid X Receptor alpha/RXRA Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
TGM2 Antibody
CSB-PA546098-01 50 μL

TGM2 Antibody

Sign In for Pricing
View Details
TGM2 Antibody
CSB-PA546098-02 100 µL

TGM2 Antibody

Sign In for Pricing
View Details
Lentiviral human TMC5 shRNA (UAS) - Lentiviral human TMC5 shRNA (UAS, RFP) (25)
GTR15329966 1 Vial

Lentiviral human TMC5 shRNA (UAS) - Lentiviral human TMC5 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details