Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA8 Rabbit Polyclonal Antibody (FITC)

HSPA8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LAP1, HSC54, HSC70, HSC71, HSP71, HSP73, LAP-1, NIP71, HEL-33, HSPA10, HEL-S-72p

UniProt

P11142

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Human, Mouse, Porcine, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006588

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FASTKD2 Antibody
MBS9413210-01 0.1 mL

FASTKD2 Antibody

Sign In for Pricing
View Details
FASTKD2 Antibody
MBS9413210-02 5x 0.1 mL

FASTKD2 Antibody

Sign In for Pricing
View Details
PFK27 Antibody
orb844056 2 mg

PFK27 Antibody

Sign In for Pricing
View Details
TOMM40 (Mitochondrial Import Receptor subunit TOM40 homolog, Translocase of Outer Membrane 40kD Subunit Homolog, TOM40, PEREC1, C19orf1, PER-EC1, D19S1177E) (MaxLight 405)
MBS6441186-01 0.1 mL

TOMM40 (Mitochondrial Import Receptor subunit TOM40 homolog, Translocase of Outer Membrane 40kD Subunit Homolog, TOM40, PEREC1, C19orf1, PER-EC1, D19S1177E) (MaxLight 405)

Sign In for Pricing
View Details
TOMM40 (Mitochondrial Import Receptor subunit TOM40 homolog, Translocase of Outer Membrane 40kD Subunit Homolog, TOM40, PEREC1, C19orf1, PER-EC1, D19S1177E) (MaxLight 405)
MBS6441186-02 5x 0.1 mL

TOMM40 (Mitochondrial Import Receptor subunit TOM40 homolog, Translocase of Outer Membrane 40kD Subunit Homolog, TOM40, PEREC1, C19orf1, PER-EC1, D19S1177E) (MaxLight 405)

Sign In for Pricing
View Details
Human EXOC3L2 Protein Lysate
MBS8411290-01 0.02 mg

Human EXOC3L2 Protein Lysate

Sign In for Pricing
View Details