Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA8 Rabbit Polyclonal Antibody (FITC)

HSPA8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LAP1, HSC54, HSC70, HSC71, HSP71, HSP73, LAP-1, NIP71, HEL-33, HSPA10, HEL-S-72p

UniProt

P11142

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Goat, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006588

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REM1 (Rad and Gem-like GTP-binding Protein 1, REM, GTP-binding Protein REM 1, GTPase-regulating Endothelial Cell Sprouting, GES) (MaxLight 750)
MBS6234948-01 0.1 mL

REM1 (Rad and Gem-like GTP-binding Protein 1, REM, GTP-binding Protein REM 1, GTPase-regulating Endothelial Cell Sprouting, GES) (MaxLight 750)

Sign In for Pricing
View Details
REM1 (Rad and Gem-like GTP-binding Protein 1, REM, GTP-binding Protein REM 1, GTPase-regulating Endothelial Cell Sprouting, GES) (MaxLight 750)
MBS6234948-02 5x 0.1 mL

REM1 (Rad and Gem-like GTP-binding Protein 1, REM, GTP-binding Protein REM 1, GTPase-regulating Endothelial Cell Sprouting, GES) (MaxLight 750)

Sign In for Pricing
View Details
STAT3 (Ab-705) Antibody
orb14458-01 50 μL

STAT3 (Ab-705) Antibody

Sign In for Pricing
View Details
STAT3 (Ab-705) Antibody
orb14458-02 100 µL

STAT3 (Ab-705) Antibody

Sign In for Pricing
View Details
Bag of 100 Discs Nylon Mesh Filter 150µm, 47 Mm (Heat Sealed)
TF150NY0047AC Bag of 100

Bag of 100 Discs Nylon Mesh Filter 150µm, 47 Mm (Heat Sealed)

Sign In for Pricing
View Details
Anti-Slingshot-1L (Ser-978), Phosphospecific Antibody
SP3901 100 µL

Anti-Slingshot-1L (Ser-978), Phosphospecific Antibody

Sign In for Pricing
View Details